PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00301
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family Nin-like
Protein Properties Length: 851aa    MW: 95858.7 Da    PI: 5.475
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00301genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.82.5e-29568618252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  AA39G00301 568 DKNITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 618
                 69***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.336555638IPR003035RWP-RK domain
PfamPF020422.3E-25570618IPR003035RWP-RK domain
SuperFamilySSF542773.43E-21743835No hitNo description
PROSITE profilePS5174525.037750833IPR000270PB1 domain
SMARTSM006669.5E-24750833IPR000270PB1 domain
CDDcd064079.08E-40751831No hitNo description
PfamPF005643.9E-17751831IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.9E-19751830No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MEDKFLQSGN LLTSHPPIDS AMDTEFMDGL LLDGCWLETT DGSEFLNLTS SFDDPSSFIW  60
SPTQDSTTTT TTLCTSSNIS SQIYNQNSSE RSNLDEFQWK DLAGLNKRWW IGPSSGHNGQ  120
ISSVTERLVQ AVEHIKEYTT ERGSLIQLWV PVNRGGKRVL TTKEQPFSHD PMCQRLANYR  180
EISVNYHFSA EQDDSKALAG LPGRVFLGKL PEWTPDVRFF KSEEYPRVHH AQDCDVRGTL  240
AIPVFEQGSK ICLGVIEVVM TTEMVKLKPE LESICRALQA VDLRSTEVRI PSFLKGCDLS  300
YQAALPEIRN LLRCACETHK LPLAQTWVSC IQQSKSGCRH NDENYIHCVS TVDDACYVGD  360
STVREFHEAC SEHHLLKGQG VAGQAFLTNG PCFSPNVSNY KKSEYPLSHH AAMFGLHGAV  420
AIRLRCIHTG LVDFVLEFFL PKDCDDLEEQ RKMLNALSTI MAHVPRSLRT VTDQELEEEE  480
NDLMVSEVTL EREDRVPKME NNHVQEWSGI QQSYSNNTEN LGLVFDGGEK SNDGFGLKRG  540
FESGKDSNVN ESIFSSGGFT EKKRTKADKN ITLDVLRQYF AGSLKDAAKN IGVCPTTLKR  600
ICRQHGIQRW PSRKIKKVGH SLQKIQRVID SVQGVSGPLP ISSFYTNFPN LATTQTKTPQ  660
PQLQPPQPQP LDTYTAPLKS PVSSYSPSSS SSQCCSSETQ LNSGTDPTNG GNLVLKKLTN  720
NETELQSSCL DEKDGSSLQE TQSCVLEDDF LRLKVSFGEE KIRFRMRNSR RLSDVKWEIG  780
KRFNVEDLRR YDLKYLDEDN EWVLLTCDED VEECVDICRT SPNQTIKLLL QISSHQFLER  840
SSATEYLPPW Q
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306759.10.0hypothetical protein CARUB_v10008300mg
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLR0GUM30.0R0GUM3_9BRAS; Uncharacterized protein
STRINGAT1G20640.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein